PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen03g026750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 428aa    MW: 49546.1 Da    PI: 5.5809
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen03g026750.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3357.32.9e-109293122291
                       XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraW 94 
                       +lkkrmwkd+m+l++lk ++  +  +k+   + +++ k +eq+rrkkmsraQD+iLkYM+k+mevc+ qGfvYgi+ ekgkpv+g+sdsLr+W
  Sopen03g026750.1  29 DLKKRMWKDRMKLEKLKAKRDMSS-SKDD--SDETEAKQEEQSRRKKMSRAQDSILKYMVKIMEVCQGQGFVYGIVGEKGKPVSGSSDSLREW 118
                       9*************9999888755.3333..34556899****************************************************** PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT-- CS
              EIN3  95 WkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgls 187
                       Wkekv+f++ +paai++    +l+ + +     + ss  h l++l D tl+ LLs+lmqhc ppqr fple+g++pPWWPtGkelwwg +gls
  Sopen03g026750.1 119 WKEKVRFEQSAPAAIADF-LPKLVED-NII--LDTSSHIHHLEDLRDGTLSTLLSTLMQHCHPPQRIFPLERGLAPPWWPTGKELWWGDQGLS 207
                       *****************9.3455533.222..357999******************************************************* PP

                       TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX....XXXXXXXXXXX CS
              EIN3 188 kdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss....slrkqspkvtl 276
                       ++qg+ppy+kphdlkkawkv+vL+a ik m p+++++r+l+ qs++lq+km+ake++++++ +nqee++++    + +    s     ++v +
  Sopen03g026750.1 208 QEQGPPPYRKPHDLKKAWKVTVLAAIIKNMTPNLDRMRRLVTQSRSLQNKMTAKETATWSKLVNQEEALVNLTDKSLKeedlS--LVPKNVLI 298
                       ********************************************************************997655553333331..22223333 PP

                       XXXXXXXXXXXXXXX CS
              EIN3 277 sceqkedvegkkesk 291
                       +++  ++++ k++ +
  Sopen03g026750.1 299 DKS-ARRRKYKRKCN 312
                       333.22333222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048736.5E-11028274No hitNo description
Gene3DG3DSA:1.10.3180.106.8E-62150279IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.7E-55153277IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MVKVDEIVDP WGDPMRELLE VEENISYNDL KKRMWKDRMK LEKLKAKRDM SSSKDDSDET  60
EAKQEEQSRR KKMSRAQDSI LKYMVKIMEV CQGQGFVYGI VGEKGKPVSG SSDSLREWWK  120
EKVRFEQSAP AAIADFLPKL VEDNIILDTS SHIHHLEDLR DGTLSTLLST LMQHCHPPQR  180
IFPLERGLAP PWWPTGKELW WGDQGLSQEQ GPPPYRKPHD LKKAWKVTVL AAIIKNMTPN  240
LDRMRRLVTQ SRSLQNKMTA KETATWSKLV NQEEALVNLT DKSLKEEDLS LVPKNVLIDK  300
SARRRKYKRK CNFEHDTRCP YRENGGLNDQ ESINCEDQLE AQTLPREEWI AKEEEISPHD  360
WMNMEIQKSF NNYDAQFTAC SGIQKNFESY SGENHVLEQL LSDPETCGSM NIDGTQSEAE  420
IATSIWEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-531512771127Protein ETHYLENE INSENSITIVE 3
4zds_B2e-531512771127Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1303309RRKYKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754420.0HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015069513.10.0PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9LX161e-114EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLK4BJ810.0K4BJ81_SOLLC; Uncharacterized protein
STRINGSolyc03g096630.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-114EIL family protein